Rabbit NSE(Enolase, Neuron Specific) ELISA Kit
To Order Contact us: Yamada@jsce-ip.com
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Rb-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Rb-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Rb-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Rb-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Hu-48T |
DL Develop |
48T |
EUR 479 |
- Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Hu-96T |
DL Develop |
96T |
EUR 621 |
- Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Mu-48T |
DL Develop |
48T |
EUR 489 |
- Should the Mouse Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Mu-96T |
DL Develop |
96T |
EUR 635 |
- Should the Mouse Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Ra-48T |
DL Develop |
48T |
EUR 508 |
- Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
DLR-NSE-Ra-96T |
DL Develop |
96T |
EUR 661 |
- Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
|
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 500 |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 692 |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 534 |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
RDR-NSE-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 742 |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Hu-48Tests |
Reddot Biotech |
48 Tests |
EUR 478 |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Hu-96Tests |
Reddot Biotech |
96 Tests |
EUR 662 |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Mu-48Tests |
Reddot Biotech |
48 Tests |
EUR 489 |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Mu-96Tests |
Reddot Biotech |
96 Tests |
EUR 677 |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Ra-48Tests |
Reddot Biotech |
48 Tests |
EUR 511 |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
RD-NSE-Ra-96Tests |
Reddot Biotech |
96 Tests |
EUR 709 |
Neuron Specific Enolase (NSE) |
CH22126 |
Neuromics |
100 ul of serum |
EUR 409 |
Rabbit Neuron-specific enolase,NSE ELISA Kit |
CN-00683R1 |
ChemNorm |
96T |
EUR 464 |
Rabbit Neuron-specific enolase,NSE ELISA Kit |
CN-00683R2 |
ChemNorm |
48T |
EUR 313 |
Rabbit Neuron-specific enolase,NSE ELISA Kit |
GA-E0147RB-48T |
GenAsia Biotech |
48T |
EUR 326 |
Rabbit Neuron-specific enolase,NSE ELISA Kit |
GA-E0147RB-96T |
GenAsia Biotech |
96T |
EUR 524 |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Rb-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4626.78 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<1
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Rb-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 468.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<1
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Rb-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 626.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<1
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Rb-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2520.06 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<1
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids. |
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit |
4-SEA537Rb |
Cloud-Clone |
-
EUR 4677.00
-
EUR 2471.00
-
EUR 627.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
- Enolase 2
- Gamma Enolase
- 2-phospho-D-glycerate hydro-lyase
- Neural enolase
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rabbit Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species. |
Rabbit Enolase, Neuron Specific ELISA Kit (NSE) |
RK03429 |
Abclonal |
96 Tests |
EUR 521 |
Rabbit Enolase, Neuron Specific (NSE) Protein |
20-abx653280 |
Abbexa |
-
EUR 648.00
-
EUR 272.00
-
EUR 1998.00
-
EUR 773.00
-
EUR 467.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
ELISA kit for Rabbit NSE (Enolase, Neuron Specific) |
ELK3039 |
ELK Biotech |
1 plate of 96 wells |
EUR 526 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
- Show more
|
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rabbit in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
Neuron Specific Enolase (NSE) Antibody |
abx020636-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Neuron Specific Enolase (NSE) Antibody |
abx020637-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Neuron Specific Enolase (NSE) Antibody |
abx020638-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Neuron Specific Enolase (NSE) Antibody |
abx020639-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Neuron Specific Enolase (NSE) Antibody |
abx020640-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Neuron Specific Enolase (NSE) Antibody |
abx020641-1mg |
Abbexa |
1 mg |
EUR 829 |
- Shipped within 5-10 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx102347 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1107.00
-
EUR 537.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx102348 |
Abbexa |
-
EUR 398.00
-
EUR 133.00
-
EUR 1107.00
-
EUR 537.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx102349 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx102350 |
Abbexa |
-
EUR 425.00
-
EUR 133.00
-
EUR 1177.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Neuron-Specific Enolase (NSE) Antibody |
abx037440-100ug |
Abbexa |
100 ug |
EUR 391 |
- Shipped within 5-10 working days.
|
Neuron-Specific Enolase (NSE) Antibody |
abx037802-100ug |
Abbexa |
100 ug |
EUR 391 |
- Shipped within 5-10 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx129524 |
Abbexa |
-
EUR 411.00
-
EUR 133.00
-
EUR 1135.00
-
EUR 551.00
-
EUR 314.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-12 working days.
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx172246 |
Abbexa |
|
|
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx172247 |
Abbexa |
|
|
|
Enolase, Neuron Specific (NSE) Antibody |
20-abx270247 |
Abbexa |
-
EUR 467.00
-
EUR 537.00
-
EUR 272.00
-
EUR 815.00
-
EUR 356.00
|
-
100 tests
-
200 tests
-
25 tests
-
500 tests
-
50 tests
|
- Shipped within 5-7 working days.
|
Neuron Specific Enolase (NSE)/ENO2 |
CH23003 |
Neuromics |
100 ul |
EUR 179 |
Neuron-Specific Enolase (NSE) Antibody |
abx411075-02mg |
Abbexa |
0.2 mg |
EUR 565 |
|
Neuron-Specific Enolase (NSE) Antibody |
abx411512-02mg |
Abbexa |
0.2 mg |
EUR 565 |
|
Neuron-Specific Enolase (NSE) Antibody |
abx235865-100ug |
Abbexa |
100 ug |
EUR 481 |
- Shipped within 5-12 working days.
|
Neuron-Specific Enolase (NSE) Antibody |
abx235866-100ug |
Abbexa |
100 ug |
EUR 481 |
- Shipped within 5-12 working days.
|
Neuron-Specific Enolase (NSE) Antibody |
abx235867-100ug |
Abbexa |
100 ug |
EUR 509 |
- Shipped within 5-12 working days.
|
Neuron Specific Enolase (NSE)/ENO2 |
RA22110 |
Neuromics |
100 ul |
EUR 409 |
Recombinant Enolase, Neuron Specific (NSE) |
4-RPA537Hu01 |
Cloud-Clone |
-
EUR 413.60
-
EUR 214.00
-
EUR 1276.00
-
EUR 492.00
-
EUR 884.00
-
EUR 340.00
-
EUR 3040.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P09104
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 49.0kDa
- Isoelectric Point: 5.1
|
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli |
Recombinant Enolase, Neuron Specific (NSE) |
4-RPA537Hu02 |
Cloud-Clone |
-
EUR 413.60
-
EUR 214.00
-
EUR 1276.00
-
EUR 492.00
-
EUR 884.00
-
EUR 340.00
-
EUR 3040.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Q6IFW5
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 37.1kDa
- Isoelectric Point: 5.1
|
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli |
Recombinant Enolase, Neuron Specific (NSE) |
4-RPA537Mu01 |
Cloud-Clone |
-
EUR 440.48
-
EUR 221.00
-
EUR 1376.80
-
EUR 525.60
-
EUR 951.20
-
EUR 358.00
-
EUR 3292.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Q545V3
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 36.1kDa
- Isoelectric Point: 5.2
|
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli |
Recombinant Enolase, Neuron Specific (NSE) |
4-RPA537Mu02 |
Cloud-Clone |
-
EUR 440.48
-
EUR 221.00
-
EUR 1376.80
-
EUR 525.60
-
EUR 951.20
-
EUR 358.00
-
EUR 3292.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: Q545V3
- Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 48.7kDa
- Isoelectric Point: 5.2
|
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli |
Recombinant Enolase, Neuron Specific (NSE) |
4-RPA537Ra01 |
Cloud-Clone |
-
EUR 440.48
-
EUR 221.00
-
EUR 1376.80
-
EUR 525.60
-
EUR 951.20
-
EUR 358.00
-
EUR 3292.00
|
-
100 ug
-
10ug
-
1 mg
-
200 ug
-
500 ug
-
50ug
-
5 mg
|
- Uniprot ID: P07323
- Buffer composition: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
- Form: Freeze-dried powder
- Predicted Molecular Mass (KD): 48.5kDa
- Isoelectric Point: 5.3
|
Description: Recombinant Rat Enolase, Neuron Specific expressed in: E.coli |
Human Neuron Specific Enolase (NSE) ELISA |
LF-EK0169 |
Abfrontier |
1×96T |
EUR 603 |
Human Neuron-specific enolase,NSE ELISA Kit |
201-12-0938 |
SunredBio |
96 tests |
EUR 440 |
- This Neuron-specific enolase ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
|
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids. |
Human NSE(Neuron-specific Enolase) ELISA Kit |
EH0370 |
FN Test |
96T |
EUR 476.25 |
- Detection range: 2.344-150 ng/ml
- Uniprot ID: P09104
- Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 1.406 ng/ml |
Human Neuron-specific enolase, NSE ELISA Kit |
CSB-E07961h-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Human Neuron-specific enolase, NSE ELISA Kit |
1-CSB-E07961h |
Cusabio |
-
EUR 703.00
-
EUR 4843.00
-
EUR 2570.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Mouse Neuron-specific enolase, NSE ELISA Kit |
CSB-E07962m-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Mouse Neuron-specific enolase, NSE ELISA Kit |
1-CSB-E07962m |
Cusabio |
-
EUR 703.00
-
EUR 4843.00
-
EUR 2570.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Neuron-specific enolase, NSE ELISA Kit |
CSB-E07963r-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Rat Neuron-specific enolase, NSE ELISA Kit |
1-CSB-E07963r |
Cusabio |
-
EUR 967.00
-
EUR 5925.00
-
EUR 3134.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Pig Neuron-specific enolase, NSE ELISA Kit |
CSB-E14065p-24T |
Cusabio |
1 plate of 24 wells |
EUR 165 |
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price. |
Pig Neuron-specific enolase, NSE ELISA Kit |
1-CSB-E14065p |
Cusabio |
-
EUR 967.00
-
EUR 5925.00
-
EUR 3134.00
|
-
1 plate of 96 wells
-
10 plates of 96 wells each
-
5 plates of 96 wells each
|
- Sample volume: 50-100ul
- Detection wavelength: 450nm
- Assay performance time: 1 to 4 hours.
|
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits. |
Rat Neuron-specific enolase,NSE ELISA Kit |
CN-01476R1 |
ChemNorm |
96T |
EUR 442 |
Rat Neuron-specific enolase,NSE ELISA Kit |
CN-01476R2 |
ChemNorm |
48T |
EUR 293 |
Mouse Neuron-specific enolase,NSE ELISA Kit |
CN-02346M1 |
ChemNorm |
96T |
EUR 439 |
Mouse Neuron-specific enolase,NSE ELISA Kit |
CN-02346M2 |
ChemNorm |
48T |
EUR 290 |
Human Neuron-specific enolase,NSE ELISA Kit |
CN-03318H1 |
ChemNorm |
96T |
EUR 455 |
Human Neuron-specific enolase,NSE ELISA Kit |
CN-03318H2 |
ChemNorm |
48T |
EUR 304 |
Mouse NSE(Neuron-Specific Enolase) ELISA Kit |
EM1242 |
FN Test |
96T |
EUR 476.25 |
- Detection range: 78.125-5000 pg/ml
- Uniprot ID: P17183
- Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 46.875pg/ml |
Rat NSE(Neuron Specific Enolase) ELISA Kit |
ER1200 |
FN Test |
96T |
EUR 476.25 |
- Detection range: 0.313-20 ng/ml
- Uniprot ID: P07323
- Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.188 ng/ml |
Sheep NSE(Neuron-Specific Enolase) ELISA Kit |
ESH0022 |
FN Test |
96T |
EUR 567.6 |
- Detection range: 3.125-200 ng/ml
- Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
|
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Sheep;Sensitivity: 1.875 ng/ml |
Rat Neuron-specific enolase(NSE)ELISA Kit |
GA-E0549RT-48T |
GenAsia Biotech |
48T |
EUR 317 |
Rat Neuron-specific enolase(NSE)ELISA Kit |
GA-E0549RT-96T |
GenAsia Biotech |
96T |
EUR 496 |
Mouse Neuron-specific enolase(NSE)ELISA Kit |
GA-E0582MS-48T |
GenAsia Biotech |
48T |
EUR 336 |
Mouse Neuron-specific enolase(NSE)ELISA Kit |
GA-E0582MS-96T |
GenAsia Biotech |
96T |
EUR 534 |
Human Neuron-specific enolase(NSE)ELISA Kit |
GA-E0954HM-48T |
GenAsia Biotech |
48T |
EUR 289 |
Human Neuron-specific enolase(NSE)ELISA Kit |
GA-E0954HM-96T |
GenAsia Biotech |
96T |
EUR 466 |
Human Enolase, Neuron Specific ELISA Kit (NSE) |
RK01966 |
Abclonal |
96 Tests |
EUR 521 |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Hu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4273.35 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Hu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 439.57 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Hu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 585.1 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Hu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2332.95 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Human Enolase, Neuron Specific (NSE) ELISA Kit |
4-SEA537Hu |
Cloud-Clone |
-
EUR 4324.00
-
EUR 2283.00
-
EUR 586.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
- Enolase 2
- Gamma Enolase
- 2-phospho-D-glycerate hydro-lyase
- Neural enolase
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Mu-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4391.16 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Mu-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 449.27 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Mu-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 598.96 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Mu-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2395.32 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12
- Show more
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Mouse Enolase, Neuron Specific (NSE) ELISA Kit |
4-SEA537Mu |
Cloud-Clone |
-
EUR 4442.00
-
EUR 2346.00
-
EUR 599.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
- Enolase 2
- Gamma Enolase
- 2-phospho-D-glycerate hydro-lyase
- Neural enolase
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Ra-10x96wellstestplate |
Cloud-Clone |
10x96-wells test plate |
EUR 4626.78 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12%
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Ra-1x48wellstestplate |
Cloud-Clone |
1x48-wells test plate |
EUR 468.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12%
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Ra-1x96wellstestplate |
Cloud-Clone |
1x96-wells test plate |
EUR 626.68 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12%
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
SEA537Ra-5x96wellstestplate |
Cloud-Clone |
5x96-wells test plate |
EUR 2520.06 |
- The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
- CV(%) = SD/meanX100
- Intra-Assay: CV<10%
- Inter-Assay: CV<12%
|
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids. |
Rat Enolase, Neuron Specific (NSE) ELISA Kit |
4-SEA537Ra |
Cloud-Clone |
-
EUR 4677.00
-
EUR 2471.00
-
EUR 627.00
|
-
10 plates of 96 wells
-
5 plates of 96 wells
-
1 plate of 96 wells
|
- Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
- Enolase 2
- Gamma Enolase
- 2-phospho-D-glycerate hydro-lyase
- Neural enolase
|
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species. |
Rat Enolase, Neuron Specific ELISA Kit (NSE) |
RK03850 |
Abclonal |
96 Tests |
EUR 521 |
Human Recombinant Neuron-Specific Enolase (NSE) |
6362-100 |
Biovision |
|
EUR 457 |
Enolase, Neuron Specific (NSE) Antibody (APC) |
20-abx176282 |
Abbexa |
|
|
|
Mouse Enolase, Neuron Specific (NSE) Protein |
20-abx167196 |
Abbexa |
-
EUR 620.00
-
EUR 272.00
-
EUR 1859.00
-
EUR 732.00
-
EUR 453.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Enolase, Neuron Specific (NSE) Protein |
20-abx066423 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Mouse Enolase, Neuron Specific (NSE) Protein |
20-abx066424 |
Abbexa |
-
EUR 620.00
-
EUR 272.00
-
EUR 1859.00
-
EUR 732.00
-
EUR 453.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-7 working days.
|
Human Enolase, Neuron Specific (NSE) Protein |
20-abx066426 |
Abbexa |
-
EUR 578.00
-
EUR 258.00
-
EUR 1720.00
-
EUR 690.00
-
EUR 425.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-12 working days.
|
Polyclonal Neuron Specific Enolase (NSE) Antibody |
APR08718G |
Leading Biology |
0.1ml |
EUR 484 |
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Neuron Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications: |
Polyclonal Neuron-Specific Enolase (NSE) Antibody |
APR08719G |
Leading Biology |
0.1mg |
EUR 528 |
Description: A polyclonal antibody raised in Chicken that recognizes and binds to Human Neuron-Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications: |
Enolase, Neuron Specific (NSE) Antibody (Biotin) |
20-abx271998 |
Abbexa |
-
EUR 425.00
-
EUR 230.00
-
EUR 1191.00
-
EUR 578.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Enolase, Neuron Specific (NSE) Antibody (Biotin) |
20-abx272702 |
Abbexa |
-
EUR 425.00
-
EUR 230.00
-
EUR 1219.00
-
EUR 592.00
-
EUR 328.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-12 working days.
|
Enolase, Neuron Specific (NSE) Antibody (Biotin) |
20-abx273178 |
Abbexa |
-
EUR 453.00
-
EUR 244.00
-
EUR 1288.00
-
EUR 620.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Enolase, Neuron Specific (NSE) Antibody Pair |
20-abx370057 |
Abbexa |
|
-
10 × 96 tests
-
5 × 96 tests
|
- Shipped within 5-15 working days.
|
Human Neuron-Specific Enolase (NSE) Protein |
abx670067-50ug |
Abbexa |
50 ug |
EUR 300 |
|
Enolase, Neuron Specific (NSE) Antibody (FITC) |
20-abx273791 |
Abbexa |
-
EUR 453.00
-
EUR 244.00
-
EUR 1288.00
-
EUR 620.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Enolase, Neuron Specific (NSE) Antibody (FITC) |
20-abx274000 |
Abbexa |
-
EUR 453.00
-
EUR 244.00
-
EUR 1316.00
-
EUR 634.00
-
EUR 342.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Enolase, Neuron Specific (NSE) Antibody (FITC) |
20-abx274136 |
Abbexa |
-
EUR 467.00
-
EUR 244.00
-
EUR 1386.00
-
EUR 648.00
-
EUR 356.00
|
-
100 ug
-
10 ug
-
1 mg
-
200 ug
-
50 ug
|
- Shipped within 5-15 working days.
|
Anti-Neuron Specific Enolase (NSE) Antibody |
M02930-2 |
BosterBio |
100ul |
EUR 397 |
Description: Rabbit Polyclonal Neuron Specific Enolase (NSE) Antibody. Validated in IF, IHC, ICC, WB and tested in Human, Mouse, Rat. |
Human Neuron Specific Enolase (NSE) ELISA (4X96T) |
LF-EK0170 |
Abfrontier |
4×96T |
EUR 2045 |
Human Neuron Specific Enolase (NSE) ELISA (10X96T) |
LF-EK0171 |
Abfrontier |
10×96T |
EUR 4484 |
Human Neuron Specific Enolase (NSE) ELISA (20X96T) |
LF-EK0172 |
Abfrontier |
20×96T |
EUR 7808 |
Human Neuron-Specific Enolase (NSE) CLIA Kit |
abx195569-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
Mouse Neuron-Specific Enolase (NSE) CLIA Kit |
abx197339-96tests |
Abbexa |
96 tests |
EUR 825 |
- Shipped within 5-12 working days.
|
ELISA kit for Human NSE (Neuron Specific Enolase) |
E-EL-H1047 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human NSE. Standards or samples are added to the micro ELISA plate wells and combined with the
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Human NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Mouse NSE (Neuron Specific Enolase) |
E-EL-M0089 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE. Standards or samples are added to the micro ELISA plate wells and combined with the
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Mouse NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Porcine NSE (Neuron Specific Enolase) |
E-EL-P2068 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 520 |
- Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Porcine NSE. Standards or samples are added to the micro ELISA plate wells and combined with th
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Porcine NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Rat NSE (Neuron Specific Enolase) |
E-EL-R0058 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 377 |
- Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE. Standards or samples are added to the micro ELISA plate wells and combined with the sp
- Show more
|
Description: A sandwich ELISA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
ELISA kit for Human NSE (Enolase, Neuron Specific) |
ELK2587 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
- Show more
|
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Mouse NSE (Enolase, Neuron Specific) |
ELK2588 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
- Show more
|
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
ELISA kit for Rat NSE (Enolase, Neuron Specific) |
ELK2589 |
ELK Biotech |
1 plate of 96 wells |
EUR 432 |
- The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
- Show more
|
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids. |
NSE ELISA Kit| Rat Neuron Specific Enolase ELISA Kit |
EF017922 |
Lifescience Market |
96 Tests |
EUR 689 |
NSE ELISA Kit| Sheep Neuron-Specific Enolase ELISA Kit |
EF019517 |
Lifescience Market |
96 Tests |
EUR 689 |
NSE ELISA Kit| Mouse Neuron-Specific Enolase ELISA Kit |
EF013790 |
Lifescience Market |
96 Tests |
EUR 689 |
ELISA kit for Rat Neuron-Specific Enolase (NSE) Kit |
KTE101048-48T |
Abbkine |
48T |
EUR 354 |
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Neuron-Specific Enolase (NSE) Kit |
KTE101048-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2252 |
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Neuron-Specific Enolase (NSE) Kit |
KTE101048-96T |
Abbkine |
96T |
EUR 572 |
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE) Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
CLIA kit for Human NSE (Neuron-Specific Enolase) |
E-CL-H0702 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
- Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp
- Show more
|
Description: A sandwich CLIA kit for quantitative measurement of Human NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
CLIA kit for Mouse NSE (Neuron-Specific Enolase) |
E-CL-M0076 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
- Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp
- Show more
|
Description: A sandwich CLIA kit for quantitative measurement of Mouse NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
CLIA kit for Rat NSE (Neuron Specific Enolase) |
E-CL-R0047 |
Elabscience Biotech |
1 plate of 96 wells |
EUR 584 |
- Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE . Standards or samples are added to the micro CLIA plate wells and combined with the spec
- Show more
|
Description: A sandwich CLIA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant |
Rabbit Anti-Rat neuron-specific enolase (NSE/gamma enolase) protein antiserum |
NSE13-S |
Alpha Diagnostics |
100 ul |
EUR 457 |
Rabbit Neuron Specific Enolase ELISA kit |
E04N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Neuron Specific Enolase ELISA kit |
E04N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Neuron Specific Enolase ELISA kit |
E04N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Anti-Human neuron-specific enolase (NSE/gamma enolase) peptide antiserum #1 |
NSE11-S |
Alpha Diagnostics |
100 ul |
EUR 457 |
Human brain neuron-specific enolase (NSE/gamma enolase) protein (purified) |
NSE15-N-100 |
Alpha Diagnostics |
100 ug |
EUR 408 |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse) |
4-PAA537Hu02 |
Cloud-Clone |
-
EUR 232.00
-
EUR 2285.00
-
EUR 574.00
-
EUR 289.00
-
EUR 208.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat) |
4-MAA537Hu21 |
Cloud-Clone |
-
EUR 241.00
-
EUR 2417.00
-
EUR 604.00
-
EUR 301.00
-
EUR 211.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse) |
4-MAA537Hu22 |
Cloud-Clone |
-
EUR 225.00
-
EUR 2173.00
-
EUR 548.00
-
EUR 279.00
-
EUR 205.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE) |
Neuron Specific Enolase |
PR27173 |
Neuromics |
25 ug |
EUR 318 |
Neuron Specific Enolase ELISA Kit |
E4703-100 |
Biovision |
|
EUR 588 |
Rabbit Enolase, Neuron Specific (ENO2) ELISA Kit |
20-abx155093 |
Abbexa |
-
EUR 7237.00
-
EUR 3855.00
-
EUR 895.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
- Shipped within 5-7 working days.
|
Rabbit Enolase, Neuron Specific (ENO2) ELISA Kit |
abx573336-96tests |
Abbexa |
96 tests |
EUR 754 |
- Shipped within 5-12 working days.
|
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat) |
4-PAA537Hu01 |
Cloud-Clone |
-
EUR 232.00
-
EUR 2285.00
-
EUR 574.00
-
EUR 289.00
-
EUR 208.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Met1~Leu434)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), APC |
4-PAA537Hu02-APC |
Cloud-Clone |
-
EUR 323.00
-
EUR 2969.00
-
EUR 836.00
-
EUR 409.00
-
EUR 210.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Biotinylated |
4-PAA537Hu02-Biotin |
Cloud-Clone |
-
EUR 295.00
-
EUR 2235.00
-
EUR 671.00
-
EUR 358.00
-
EUR 212.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Cy3 |
4-PAA537Hu02-Cy3 |
Cloud-Clone |
-
EUR 390.00
-
EUR 3917.00
-
EUR 1073.00
-
EUR 504.00
-
EUR 239.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), FITC |
4-PAA537Hu02-FITC |
Cloud-Clone |
-
EUR 279.00
-
EUR 2395.00
-
EUR 688.00
-
EUR 347.00
-
EUR 188.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), HRP |
4-PAA537Hu02-HRP |
Cloud-Clone |
-
EUR 297.00
-
EUR 2589.00
-
EUR 741.00
-
EUR 371.00
-
EUR 199.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), PE |
4-PAA537Hu02-PE |
Cloud-Clone |
-
EUR 279.00
-
EUR 2395.00
-
EUR 688.00
-
EUR 347.00
-
EUR 188.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE. |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat) |
4-PAA537Mu01 |
Cloud-Clone |
-
EUR 236.00
-
EUR 2338.00
-
EUR 586.00
-
EUR 294.00
-
EUR 209.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Met1~Leu434)
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat) |
4-PAA537Mu02 |
Cloud-Clone |
-
EUR 236.00
-
EUR 2338.00
-
EUR 586.00
-
EUR 294.00
-
EUR 209.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu434)
- Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
|
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat) |
4-PAA537Ra01 |
Cloud-Clone |
-
EUR 243.00
-
EUR 2457.00
-
EUR 613.00
-
EUR 305.00
-
EUR 212.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: NSE (Ser2~Leu434)
- Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
|
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE) |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), APC |
4-MAA537Hu21-APC |
Cloud-Clone |
-
EUR 336.00
-
EUR 3149.00
-
EUR 881.00
-
EUR 427.00
-
EUR 215.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with APC. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), Biotinylated |
4-MAA537Hu21-Biotin |
Cloud-Clone |
-
EUR 305.00
-
EUR 2367.00
-
EUR 704.00
-
EUR 371.00
-
EUR 216.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), Cy3 |
4-MAA537Hu21-Cy3 |
Cloud-Clone |
-
EUR 407.00
-
EUR 4157.00
-
EUR 1133.00
-
EUR 528.00
-
EUR 246.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), FITC |
4-MAA537Hu21-FITC |
Cloud-Clone |
-
EUR 289.00
-
EUR 2539.00
-
EUR 724.00
-
EUR 361.00
-
EUR 192.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with FITC. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), HRP |
4-MAA537Hu21-HRP |
Cloud-Clone |
-
EUR 308.00
-
EUR 2745.00
-
EUR 780.00
-
EUR 387.00
-
EUR 203.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with HRP. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), PE |
4-MAA537Hu21-PE |
Cloud-Clone |
-
EUR 289.00
-
EUR 2539.00
-
EUR 724.00
-
EUR 361.00
-
EUR 192.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Met1~Leu434
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with PE. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), APC |
4-MAA537Hu22-APC |
Cloud-Clone |
-
EUR 313.00
-
EUR 2816.00
-
EUR 798.00
-
EUR 394.00
-
EUR 206.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Biotinylated |
4-MAA537Hu22-Biotin |
Cloud-Clone |
-
EUR 287.00
-
EUR 2123.00
-
EUR 643.00
-
EUR 347.00
-
EUR 209.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Cy3 |
4-MAA537Hu22-Cy3 |
Cloud-Clone |
-
EUR 375.00
-
EUR 3713.00
-
EUR 1022.00
-
EUR 483.00
-
EUR 233.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), FITC |
4-MAA537Hu22-FITC |
Cloud-Clone |
-
EUR 270.00
-
EUR 2272.00
-
EUR 658.00
-
EUR 335.00
-
EUR 184.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), HRP |
4-MAA537Hu22-HRP |
Cloud-Clone |
-
EUR 288.00
-
EUR 2457.00
-
EUR 708.00
-
EUR 358.00
-
EUR 195.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP. |
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), PE |
4-MAA537Hu22-PE |
Cloud-Clone |
-
EUR 270.00
-
EUR 2272.00
-
EUR 658.00
-
EUR 335.00
-
EUR 184.00
|
-
100ul
-
10ml
-
1ml
-
200ul
-
20ul
|
- Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
- Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
|
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE. |
Rabbit Enolase, Neuron Specific (ENO2) CLIA Kit |
20-abx491612 |
Abbexa |
-
EUR 8569.00
-
EUR 4560.00
-
EUR 1052.00
|
-
10 × 96 tests
-
5 × 96 tests
-
96 tests
|
|
Rat Neuron Specific Enolase ELISA kit |
E02N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Neuron Specific Enolase ELISA kit |
E02N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rat Neuron Specific Enolase ELISA kit |
E02N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Neuron Specific Enolase ELISA kit |
E01N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Neuron Specific Enolase ELISA kit |
E01N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Human Neuron Specific Enolase ELISA kit |
E01N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Neuron Specific Enolase ELISA kit |
E03N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Neuron Specific Enolase ELISA kit |
E03N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Mouse Neuron Specific Enolase ELISA kit |
E03N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Neuron Specific Enolase ELISA kit |
E06N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Neuron Specific Enolase ELISA kit |
E06N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Goat Neuron Specific Enolase ELISA kit |
E06N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Goat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Neuron Specific Enolase ELISA kit |
E08N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Neuron Specific Enolase ELISA kit |
E08N0025-48 |
B-Gene |
1 plate of 48 wells |
EUR 520 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Dog Neuron Specific Enolase ELISA kit |
E08N0025-96 |
B-Gene |
1 plate of 96 wells |
EUR 685 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Pig Neuron Specific Enolase ELISA kit |
E07N0025-192T |
B-Gene |
192 tests |
EUR 1270 |
- Kit contents: 1. MICROTITER PLATE * 1
2. ENZYME CONJUGATE*1 vial
3. STANDARD A*1 vial
4. STANDARD B*1 vial
5. STANDARD C*1 vial
6. STANDARD D*1 vial
7. STANDARD E*1 vial
8. STANDARD F*1 vial
9. SUBSTRATE A*1 vial
10. SUBSTRATE B*1 vial
11. STOP SOLUT
- Show more
|
Description: A competitive ELISA for quantitative measurement of Porcine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |