Rabbit NSE(Enolase, Neuron Specific) ELISA Kit

Rabbit NSE(Enolase, Neuron Specific) ELISA Kit

To Order Contact us:  Yamada@jsce-ip.com

Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Rb-48Tests 48 Tests
EUR 511
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Rb-96Tests 96 Tests
EUR 709
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Rb-48Tests 48 Tests
EUR 534
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Rb-96Tests 96 Tests
EUR 742
Human Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Hu-48T 48T
EUR 479
  • Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Hu-96T 96T
EUR 621
  • Should the Human Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Mu-48T 48T
EUR 489
  • Should the Mouse Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Mu-96T 96T
EUR 635
  • Should the Mouse Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Mouse Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Ra-48T 48T
EUR 508
  • Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
DLR-NSE-Ra-96T 96T
EUR 661
  • Should the Rat Enolase, Neuron Specific (NSE) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Hu-48Tests 48 Tests
EUR 478
Human Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Hu-96Tests 96 Tests
EUR 662
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Mu-48Tests 48 Tests
EUR 489
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Mu-96Tests 96 Tests
EUR 677
Rat Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Ra-48Tests 48 Tests
EUR 511
Rat Enolase, Neuron Specific (NSE) ELISA Kit
RD-NSE-Ra-96Tests 96 Tests
EUR 709
Human Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Hu-48Tests 48 Tests
EUR 500
Human Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Hu-96Tests 96 Tests
EUR 692
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Mu-48Tests 48 Tests
EUR 511
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Mu-96Tests 96 Tests
EUR 709
Rat Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Ra-48Tests 48 Tests
EUR 534
Rat Enolase, Neuron Specific (NSE) ELISA Kit
RDR-NSE-Ra-96Tests 96 Tests
EUR 742
Neuron Specific Enolase (NSE)
CH22126 100 ul of serum
EUR 409
Rabbit Neuron-specific enolase,NSE ELISA Kit
GA-E0147RB-48T 48T
EUR 326
Rabbit Neuron-specific enolase,NSE ELISA Kit
GA-E0147RB-96T 96T
EUR 524
Rabbit Neuron-specific enolase,NSE ELISA Kit
CN-00683R1 96T
EUR 464
Rabbit Neuron-specific enolase,NSE ELISA Kit
CN-00683R2 48T
EUR 313
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<1
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<1
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<1
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Rb-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rabbit Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<1
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rabbit Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates and other biological fluids.
Rabbit Enolase, Neuron Specific (NSE) ELISA Kit
  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
  • Enolase 2
  • Gamma Enolase
  • 2-phospho-D-glycerate hydro-lyase
  • Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rabbit Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates and other biological fluids. with no significant corss-reactivity with analogues from other species.
Rabbit Enolase, Neuron Specific ELISA Kit (NSE)
RK03429 96 Tests
EUR 521
Rabbit Neuron-specific enolase,NSE ELISA Kit
QY-E30152 96T
EUR 374
Rabbit Enolase, Neuron Specific (NSE) Protein
  • EUR 648.00
  • EUR 272.00
  • EUR 1998.00
  • EUR 773.00
  • EUR 467.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
ELISA kit for Rabbit NSE (Enolase, Neuron Specific)
ELK3039 1 plate of 96 wells
EUR 526
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
  • Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rabbit in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 398.00
  • EUR 133.00
  • EUR 1107.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 398.00
  • EUR 133.00
  • EUR 1107.00
  • EUR 537.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 411.00
  • EUR 133.00
  • EUR 1135.00
  • EUR 551.00
  • EUR 314.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 425.00
  • EUR 133.00
  • EUR 1177.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Neuron-Specific Enolase (NSE) Antibody
abx037440-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.
Neuron-Specific Enolase (NSE) Antibody
abx037802-100ug 100 ug
EUR 391
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020636-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020637-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020638-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020639-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020640-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Neuron Specific Enolase (NSE) Antibody
abx020641-1mg 1 mg
EUR 829
  • Shipped within 5-10 working days.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 843.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 843.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.
Neuron-Specific Enolase (NSE) Antibody
abx411075-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Neuron-Specific Enolase (NSE) Antibody
abx411512-02mg 0.2 mg
EUR 565
  • Shipped within 1 week.
Enolase, Neuron Specific (NSE) Antibody
  • EUR 467.00
  • EUR 537.00
  • EUR 272.00
  • EUR 815.00
  • EUR 356.00
  • 100 tests
  • 200 tests
  • 25 tests
  • 500 tests
  • 50 tests
  • Shipped within 5-7 working days.
Neuron-Specific Enolase (NSE) Antibody
abx235865-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.
Neuron-Specific Enolase (NSE) Antibody
abx235866-100ug 100 ug
EUR 481
  • Shipped within 5-12 working days.
Neuron-Specific Enolase (NSE) Antibody
abx235867-100ug 100 ug
EUR 509
  • Shipped within 5-12 working days.
Neuron Specific Enolase (NSE)/ENO2
CH23003 100 ul
EUR 179
Recombinant Enolase, Neuron Specific (NSE)
  • EUR 413.60
  • EUR 214.00
  • EUR 1276.00
  • EUR 492.00
  • EUR 884.00
  • EUR 340.00
  • EUR 3040.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P09104
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 49.0kDa
  • Isoelectric Point: 5.1
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli
Recombinant Enolase, Neuron Specific (NSE)
  • EUR 413.60
  • EUR 214.00
  • EUR 1276.00
  • EUR 492.00
  • EUR 884.00
  • EUR 340.00
  • EUR 3040.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q6IFW5
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 37.1kDa
  • Isoelectric Point: 5.1
Description: Recombinant Human Enolase, Neuron Specific expressed in: E.coli
Recombinant Enolase, Neuron Specific (NSE)
  • EUR 440.48
  • EUR 221.00
  • EUR 1376.80
  • EUR 525.60
  • EUR 951.20
  • EUR 358.00
  • EUR 3292.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q545V3
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 36.1kDa
  • Isoelectric Point: 5.2
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli
Recombinant Enolase, Neuron Specific (NSE)
  • EUR 440.48
  • EUR 221.00
  • EUR 1376.80
  • EUR 525.60
  • EUR 951.20
  • EUR 358.00
  • EUR 3292.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Q545V3
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 48.7kDa
  • Isoelectric Point: 5.2
Description: Recombinant Mouse Enolase, Neuron Specific expressed in: E.coli
Recombinant Enolase, Neuron Specific (NSE)
  • EUR 440.48
  • EUR 221.00
  • EUR 1376.80
  • EUR 525.60
  • EUR 951.20
  • EUR 358.00
  • EUR 3292.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P07323
  • Buffer composition: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 48.5kDa
  • Isoelectric Point: 5.3
Description: Recombinant Rat Enolase, Neuron Specific expressed in: E.coli
Neuron Specific Enolase (NSE)/ENO2
RA22110 100 ul
EUR 409
Human Neuron Specific Enolase (NSE) ELISA
LF-EK0169 1×96T
EUR 603
Human NSE(Neuron-specific Enolase) ELISA Kit
EH0370 96T
EUR 476.25
  • Detection range: 2.344-150 ng/ml
  • Uniprot ID: P09104
  • Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 1.406 ng/ml
Human Neuron-specific enolase(NSE)ELISA Kit
GA-E0954HM-48T 48T
EUR 289
Human Neuron-specific enolase(NSE)ELISA Kit
GA-E0954HM-96T 96T
EUR 466
Rat Neuron-specific enolase(NSE)ELISA Kit
GA-E0549RT-48T 48T
EUR 317
Rat Neuron-specific enolase(NSE)ELISA Kit
GA-E0549RT-96T 96T
EUR 496
Mouse Neuron-specific enolase(NSE)ELISA Kit  
GA-E0582MS-48T 48T
EUR 336
Mouse Neuron-specific enolase(NSE)ELISA Kit  
GA-E0582MS-96T 96T
EUR 534
Rat NSE(Neuron Specific Enolase) ELISA Kit
ER1200 96T
EUR 476.25
  • Detection range: 0.313-20 ng/ml
  • Uniprot ID: P07323
  • Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 0.188 ng/ml
Sheep NSE(Neuron-Specific Enolase) ELISA Kit
ESH0022 96T
EUR 567.6
  • Detection range: 3.125-200 ng/ml
  • Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Sheep;Sensitivity: 1.875 ng/ml
Mouse NSE(Neuron-Specific Enolase) ELISA Kit
EM1242 96T
EUR 476.25
  • Detection range: 78.125-5000 pg/ml
  • Uniprot ID: P17183
  • Alias: NSE/ENO2/gamma-Enolase/enolase 2(gamma, neuronal)/gamma-enolase/Neural enolase/neuron specific gamma enolase/Neuron-specific enolase
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 46.875pg/ml
Human Neuron-specific enolase,NSE ELISA Kit
201-12-0938 96 tests
EUR 440
  • This Neuron-specific enolase ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Neuron-specific enolase, NSE ELISA Kit
CSB-E07961h-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Neuron-specific enolase, NSE ELISA Kit
  • EUR 703.00
  • EUR 4843.00
  • EUR 2570.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitative sandwich ELISA kit for measuring Human Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Mouse Neuron-specific enolase, NSE ELISA Kit
CSB-E07962m-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Mouse Neuron-specific enolase, NSE ELISA Kit
  • EUR 703.00
  • EUR 4843.00
  • EUR 2570.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Neuron-specific enolase, NSE in samples from serum, plasma, cell culture supernates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat Neuron-specific enolase, NSE ELISA Kit
CSB-E07963r-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Rat Neuron-specific enolase, NSE ELISA Kit
  • EUR 967.00
  • EUR 5925.00
  • EUR 3134.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Pig Neuron-specific enolase, NSE ELISA Kit
CSB-E14065p-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Pig Neuron-specific enolase, NSE ELISA Kit
  • EUR 967.00
  • EUR 5925.00
  • EUR 3134.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig Neuron-specific enolase, NSE in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Rat Neuron-specific enolase,NSE ELISA Kit
CN-01476R1 96T
EUR 442
Rat Neuron-specific enolase,NSE ELISA Kit
CN-01476R2 48T
EUR 293
Mouse Neuron-specific enolase,NSE ELISA Kit
CN-02346M1 96T
EUR 439
Mouse Neuron-specific enolase,NSE ELISA Kit
CN-02346M2 48T
EUR 290
Human Neuron-specific enolase,NSE ELISA Kit
CN-03318H1 96T
EUR 455
Human Neuron-specific enolase,NSE ELISA Kit
CN-03318H2 48T
EUR 304
Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-10x96wellstestplate 10x96-wells test plate
EUR 4273.35
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-1x48wellstestplate 1x48-wells test plate
EUR 439.57
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-1x96wellstestplate 1x96-wells test plate
EUR 585.1
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Hu-5x96wellstestplate 5x96-wells test plate
EUR 2332.95
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Human Enolase, Neuron Specific (NSE) ELISA Kit
  • EUR 4324.00
  • EUR 2283.00
  • EUR 586.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
  • Enolase 2
  • Gamma Enolase
  • 2-phospho-D-glycerate hydro-lyase
  • Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-10x96wellstestplate 10x96-wells test plate
EUR 4391.16
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-1x48wellstestplate 1x48-wells test plate
EUR 449.27
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-1x96wellstestplate 1x96-wells test plate
EUR 598.96
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Mu-5x96wellstestplate 5x96-wells test plate
EUR 2395.32
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Mouse Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Mouse Enolase, Neuron Specific (NSE) ELISA Kit
  • EUR 4442.00
  • EUR 2346.00
  • EUR 599.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
  • Enolase 2
  • Gamma Enolase
  • 2-phospho-D-glycerate hydro-lyase
  • Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Mouse Enolase, Neuron Specific (NSE) in samples from Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-10x96wellstestplate 10x96-wells test plate
EUR 4626.78
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-1x48wellstestplate 1x48-wells test plate
EUR 468.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-1x96wellstestplate 1x96-wells test plate
EUR 626.68
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
SEA537Ra-5x96wellstestplate 5x96-wells test plate
EUR 2520.06
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Rat Enolase, Neuron Specific (NSE) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Rat Enolase, Neuron Specific (NSE) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
Rat Enolase, Neuron Specific (NSE) ELISA Kit
  • EUR 4677.00
  • EUR 2471.00
  • EUR 627.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Enolase, Neuron Specific elisa. Alternative names of the recognized antigen: ENO2
  • Enolase 2
  • Gamma Enolase
  • 2-phospho-D-glycerate hydro-lyase
  • Neural enolase
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Rat Enolase, Neuron Specific (NSE) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.
Human Enolase, Neuron Specific ELISA Kit (NSE)
RK01966 96 Tests
EUR 521
Rat Enolase, Neuron Specific ELISA Kit (NSE)
RK03850 96 Tests
EUR 521
Human Neuron-specific enolase(NSE)ELISA Kit
QY-E01645 96T
EUR 394
Rat Neuron-specific enolase(NSE)ELISA Kit
QY-E11103 96T
EUR 361
Mouse Neuron-specific enolase(NSE)ELISA Kit
QY-E21075 96T
EUR 361
Polyclonal Neuron Specific Enolase (NSE) Antibody
APR08718G 0.1ml
EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Neuron Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications:
Polyclonal Neuron-Specific Enolase (NSE) Antibody
APR08719G 0.1mg
EUR 528
Description: A polyclonal antibody raised in Chicken that recognizes and binds to Human Neuron-Specific Enolase (NSE) . This antibody is tested and proven to work in the following applications:
Human Neuron-Specific Enolase (NSE) Protein
abx670067-50ug 50 ug
EUR 300
  • Shipped within 1 week.
Human Enolase, Neuron Specific (NSE) Protein
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Mouse Enolase, Neuron Specific (NSE) Protein
  • EUR 620.00
  • EUR 272.00
  • EUR 1859.00
  • EUR 732.00
  • EUR 453.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Human Enolase, Neuron Specific (NSE) Protein
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Mouse Enolase, Neuron Specific (NSE) Protein
  • EUR 620.00
  • EUR 272.00
  • EUR 1859.00
  • EUR 732.00
  • EUR 453.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.
Enolase, Neuron Specific (NSE) Antibody (APC)
  • EUR 1177.00
  • EUR 578.00
  • 1 mg
  • 200 ug
  • Please enquire.
Enolase, Neuron Specific (NSE) Antibody (FITC)
  • EUR 453.00
  • EUR 244.00
  • EUR 1288.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Enolase, Neuron Specific (NSE) Antibody (FITC)
  • EUR 453.00
  • EUR 244.00
  • EUR 1316.00
  • EUR 634.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Enolase, Neuron Specific (NSE) Antibody (FITC)
  • EUR 467.00
  • EUR 244.00
  • EUR 1386.00
  • EUR 648.00
  • EUR 356.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Enolase, Neuron Specific (NSE) Antibody Pair
  • EUR 1595.00
  • EUR 1024.00
  • 10 × 96 tests
  • 5 × 96 tests
  • Shipped within 5-15 working days.
Enolase, Neuron Specific (NSE) Antibody (Biotin)
  • EUR 425.00
  • EUR 230.00
  • EUR 1191.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Enolase, Neuron Specific (NSE) Antibody (Biotin)
  • EUR 425.00
  • EUR 230.00
  • EUR 1219.00
  • EUR 592.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-12 working days.
Enolase, Neuron Specific (NSE) Antibody (Biotin)
  • EUR 453.00
  • EUR 244.00
  • EUR 1288.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.
Human Recombinant Neuron-Specific Enolase (NSE)
EUR 457
Anti-Neuron Specific Enolase (NSE) Antibody
M02930-2 100ul
EUR 397
Description: Rabbit Polyclonal Neuron Specific Enolase (NSE) Antibody. Validated in IF, IHC, ICC, WB and tested in Human, Mouse, Rat.
Anti-NSE (Neuron specific enolase) antibody
STJ120175 100 µl
EUR 469
Human Neuron Specific Enolase (NSE) ELISA (4X96T)
LF-EK0170 4×96T
EUR 2045
Human Neuron Specific Enolase (NSE) ELISA (10X96T)
LF-EK0171 10×96T
EUR 4484
Human Neuron Specific Enolase (NSE) ELISA (20X96T)
LF-EK0172 20×96T
EUR 7808
Human Neuron-Specific Enolase (NSE) CLIA Kit
abx195569-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
Mouse Neuron-Specific Enolase (NSE) CLIA Kit
abx197339-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.
ELISA kit for Mouse NSE (Neuron Specific Enolase)
E-EL-M0089 1 plate of 96 wells
EUR 377
  • Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE. Standards or samples are added to the micro ELISA plate wells and combined with the
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Mouse NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human NSE (Enolase, Neuron Specific)
ELK2587 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
  • Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Mouse NSE (Enolase, Neuron Specific)
ELK2588 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
  • Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Rat NSE (Enolase, Neuron Specific)
ELK2589 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Enolase, Neuron Specific (NSE). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific to Eno
  • Show more
Description: A sandwich ELISA kit for detection of Enolase, Neuron Specific from Rat in samples from blood, serum, plasma, cell culture fluid and other biological fluids.
ELISA kit for Porcine NSE (Neuron Specific Enolase)
E-EL-P2068 1 plate of 96 wells
EUR 520
  • Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Porcine NSE. Standards or samples are added to the micro ELISA plate wells and combined with th
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Porcine NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Rat NSE (Neuron Specific Enolase)
E-EL-R0058 1 plate of 96 wells
EUR 377
  • Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE. Standards or samples are added to the micro ELISA plate wells and combined with the sp
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant
ELISA kit for Human NSE (Neuron Specific Enolase)
E-EL-H1047 1 plate of 96 wells
EUR 377
  • Gentaur's NSE ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human NSE. Standards or samples are added to the micro ELISA plate wells and combined with the
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant
NSE ELISA Kit| Sheep Neuron-Specific Enolase ELISA Kit
EF019517 96 Tests
EUR 689
NSE ELISA Kit| Rat Neuron Specific Enolase ELISA Kit
EF017922 96 Tests
EUR 689
NSE ELISA Kit| Mouse Neuron-Specific Enolase ELISA Kit
EF013790 96 Tests
EUR 689
ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-48T 48T
EUR 354
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-5platesof96wells 5 plates of 96 wells
EUR 2252
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
ELISA kit for Rat Neuron-Specific Enolase (NSE)  Kit
KTE101048-96T 96T
EUR 572
Description: Quantitative sandwich ELISA for measuring Rat Neuron-Specific Enolase (NSE)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
CLIA kit for Human NSE (Neuron-Specific Enolase)
E-CL-H0702 1 plate of 96 wells
EUR 584
  • Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Human NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant
CLIA kit for Mouse NSE (Neuron-Specific Enolase)
E-CL-M0076 1 plate of 96 wells
EUR 584
  • Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Mouse NSE . Standards or samples are added to the micro CLIA plate wells and combined with the sp
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Mouse NSE (Neuron-Specific Enolase) in samples from Serum, Plasma, Cell supernatant
CLIA kit for Rat NSE (Neuron Specific Enolase)
E-CL-R0047 1 plate of 96 wells
EUR 584
  • Gentaur's NSE CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Rat NSE . Standards or samples are added to the micro CLIA plate wells and combined with the spec
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Rat NSE (Neuron Specific Enolase) in samples from Serum, Plasma, Cell supernatant
Rabbit Anti-Rat neuron-specific enolase (NSE/gamma enolase) protein antiserum
NSE13-S 100 ul
EUR 457
Rabbit Neuron Specific Enolase ELISA kit
E04N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Neuron Specific Enolase ELISA kit
E04N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Neuron Specific Enolase ELISA kit
E04N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rabbit Neuron- specific enolase ELISA Kit
ELA-E0537Rb 96 Tests
EUR 928
Rabbit Anti-Human neuron-specific enolase (NSE/gamma enolase) peptide antiserum #1
NSE11-S 100 ul
EUR 457
Human brain neuron-specific enolase (NSE/gamma enolase) protein (purified)
NSE15-N-100 100 ug
EUR 408
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse)
  • EUR 232.00
  • EUR 2285.00
  • EUR 574.00
  • EUR 289.00
  • EUR 208.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat)
  • EUR 241.00
  • EUR 2417.00
  • EUR 604.00
  • EUR 301.00
  • EUR 211.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse)
  • EUR 225.00
  • EUR 2173.00
  • EUR 548.00
  • EUR 279.00
  • EUR 205.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE)
Neuron Specific Enolase
PR27173 25 ug
EUR 318
Neuron Specific Enolase ELISA Kit
EUR 588
Rabbit Enolase, Neuron Specific (ENO2) ELISA Kit
abx573336-96tests 96 tests
EUR 754
  • Shipped within 5-12 working days.
Rabbit Enolase, Neuron Specific (ENO2) ELISA Kit
  • EUR 7237.00
  • EUR 3855.00
  • EUR 895.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
  • EUR 232.00
  • EUR 2285.00
  • EUR 574.00
  • EUR 289.00
  • EUR 208.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Met1~Leu434)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), APC
  • EUR 323.00
  • EUR 2969.00
  • EUR 836.00
  • EUR 409.00
  • EUR 210.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Biotinylated
  • EUR 295.00
  • EUR 2235.00
  • EUR 671.00
  • EUR 358.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), Cy3
  • EUR 390.00
  • EUR 3917.00
  • EUR 1073.00
  • EUR 504.00
  • EUR 239.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), FITC
  • EUR 279.00
  • EUR 2395.00
  • EUR 688.00
  • EUR 347.00
  • EUR 188.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), HRP
  • EUR 297.00
  • EUR 2589.00
  • EUR 741.00
  • EUR 371.00
  • EUR 199.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse), PE
  • EUR 279.00
  • EUR 2395.00
  • EUR 688.00
  • EUR 347.00
  • EUR 188.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE.
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
  • EUR 236.00
  • EUR 2338.00
  • EUR 586.00
  • EUR 294.00
  • EUR 209.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Met1~Leu434)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
  • EUR 236.00
  • EUR 2338.00
  • EUR 586.00
  • EUR 294.00
  • EUR 209.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu434)
  • Buffer composition: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Polyclonal Antibody (Human, Mouse, Rat)
  • EUR 243.00
  • EUR 2457.00
  • EUR 613.00
  • EUR 305.00
  • EUR 212.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: NSE (Ser2~Leu434)
  • Buffer composition: 0.01M PBS, pH7.4, containing 0.05% Proclin-300, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human, Mouse, Rat Enolase, Neuron Specific (NSE)
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), APC
  • EUR 336.00
  • EUR 3149.00
  • EUR 881.00
  • EUR 427.00
  • EUR 215.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with APC.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), Biotinylated
  • EUR 305.00
  • EUR 2367.00
  • EUR 704.00
  • EUR 371.00
  • EUR 216.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), Cy3
  • EUR 407.00
  • EUR 4157.00
  • EUR 1133.00
  • EUR 528.00
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), FITC
  • EUR 289.00
  • EUR 2539.00
  • EUR 724.00
  • EUR 361.00
  • EUR 192.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), HRP
  • EUR 308.00
  • EUR 2745.00
  • EUR 780.00
  • EUR 387.00
  • EUR 203.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with HRP.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Rat), PE
  • EUR 289.00
  • EUR 2539.00
  • EUR 724.00
  • EUR 361.00
  • EUR 192.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Met1~Leu434
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Rat Enolase, Neuron Specific (NSE). This antibody is labeled with PE.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), APC
  • EUR 313.00
  • EUR 2816.00
  • EUR 798.00
  • EUR 394.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with APC.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Biotinylated
  • EUR 287.00
  • EUR 2123.00
  • EUR 643.00
  • EUR 347.00
  • EUR 209.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Biotin.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), Cy3
  • EUR 375.00
  • EUR 3713.00
  • EUR 1022.00
  • EUR 483.00
  • EUR 233.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with Cy3.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), FITC
  • EUR 270.00
  • EUR 2272.00
  • EUR 658.00
  • EUR 335.00
  • EUR 184.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), HRP
  • EUR 288.00
  • EUR 2457.00
  • EUR 708.00
  • EUR 358.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with HRP.
Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), PE
  • EUR 270.00
  • EUR 2272.00
  • EUR 658.00
  • EUR 335.00
  • EUR 184.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with PE.
Rabbit Enolase, Neuron Specific (ENO2) CLIA Kit
  • EUR 8569.00
  • EUR 4560.00
  • EUR 1052.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.
Rat Neuron Specific Enolase ELISA kit
E02N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Neuron Specific Enolase ELISA kit
E02N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Rat Neuron Specific Enolase ELISA kit
E02N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Rat Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Neuron Specific Enolase ELISA kit
E03N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Neuron Specific Enolase ELISA kit
E03N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Mouse Neuron Specific Enolase ELISA kit
E03N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Mouse Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Neuron Specific Enolase ELISA kit
E01N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Neuron Specific Enolase ELISA kit
E01N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Human Neuron Specific Enolase ELISA kit
E01N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Human Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Neuron Specific Enolase ELISA kit
E08N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Neuron Specific Enolase ELISA kit
E08N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Dog Neuron Specific Enolase ELISA kit
E08N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Canine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Neuron Specific Enolase ELISA kit
E09N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Neuron Specific Enolase ELISA kit
E09N0025-48 1 plate of 48 wells
EUR 520
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Monkey Neuron Specific Enolase ELISA kit
E09N0025-96 1 plate of 96 wells
EUR 685
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Monkey Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.
Pig Neuron Specific Enolase ELISA kit
E07N0025-192T 192 tests
EUR 1270
  • Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE*1 vial 3. STANDARD A*1 vial 4. STANDARD B*1 vial 5. STANDARD C*1 vial 6. STANDARD D*1 vial 7. STANDARD E*1 vial 8. STANDARD F*1 vial 9. SUBSTRATE A*1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT
  • Show more
Description: A competitive ELISA for quantitative measurement of Porcine Neuron Specific Enolase in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.